LOCUS       KP939413                 763 bp    RNA     linear   VRL 30-JUN-2016
DEFINITION  African horse sickness virus 1 isolate AHSV-1_107_09 segment 10,
            complete sequence.
ACCESSION   KP939413
VERSION     KP939413.1
KEYWORDS    .
SOURCE      African horse sickness virus 1
  ORGANISM  African horse sickness virus 1
            Viruses; dsRNA viruses; Reoviridae; Sedoreovirinae; Orbivirus.
REFERENCE   1  (bases 1 to 763)
  AUTHORS   van Schalkwyk,A., Ngoveni,H.G., Mokotoan,N. and Koekemoer,O.J.J.
  TITLE     The dynamics of African horse sickness virus evolution
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 763)
  AUTHORS   van Schalkwyk,A., Ngoveni,H.G., Mokotoan,N. and Koekemoer,O.J.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAR-2015) Molecular Epidemiology and Diagnostics,
            Agricultural Research Council - Onderstepoort Veterinary
            Institute, Old Soutpan Road, Onderstepoort, Pretoria, Gauteng
            0110, South Africa
COMMENT     ##Assembly-Data-START## Assembly Method :: CLC Genomics v. 7.0
            Sequencing Technology :: Illumina ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..763
                     /mol_type="genomic RNA"
                     /country="South Africa"
                     /segment="10"
                     /collection_date="23-Oct-2009"
                     /db_xref="taxon:33714"
                     /isolate="AHSV-1_107_09"
                     /organism="African horse sickness virus 1"
     gene            19..675
                     /gene="NS3"
     CDS             19..675
                     /codon_start=1
                     /protein_id="ALL99270.1"
                     /gene="NS3"
                     /translation="MNLASISQSYMSHNENERSIVPYIPPPYHPTAPALAVSASQMET
                     MSLGILNQAMSSSAGASGALKDEKAAFGAVAEALRDPEPIRKIKRQVGIQTLKTLKVE
                     LSGMRRKKLILKIIMFICANVTMATSLVGGMSIVDEDIAKHLAFDGKGDWVSKTVHGL
                     NLLCTTMLLAANKISEKVREEIARTKRDIAKRQSYVSAATKSWDGDSVTLLRDVKYGD
                     "
                     /product="non-structural protein 3"
     gene            49..675
                     /gene="NS3A"
     CDS             49..675
                     /codon_start=1
                     /protein_id="ALL99271.1"
                     /gene="NS3A"
                     /translation="MSHNENERSIVPYIPPPYHPTAPALAVSASQMETMSLGILNQAM
                     SSSAGASGALKDEKAAFGAVAEALRDPEPIRKIKRQVGIQTLKTLKVELSGMRRKKLI
                     LKIIMFICANVTMATSLVGGMSIVDEDIAKHLAFDGKGDWVSKTVHGLNLLCTTMLLA
                     ANKISEKVREEIARTKRDIAKRQSYVSAATKSWDGDSVTLLRDVKYGD"
                     /product="non-structural protein 3A"
ORIGIN      
        1 gttaaattat cccttgtcat gaatcttgct agcatctccc aaagctatat gtcacataat
       61 gagaatgaaa gatcaattgt accatacatt ccgccaccgt atcatccgac ggctccggcg
      121 cttgctgtat ccgccagtca aatggagacc atgtcgcttg ggatacttaa ccaagcaatg
      181 tcaagttcag ctggtgcgag cggagcactt aaggatgaaa aggcagcgtt tggagcggtg
      241 gcagaggcgt tgagagatcc ggagccgatc agaaaaatta agcgacaagt aggtatccaa
      301 actctaaaaa cactgaaagt tgaattgagc gggatgcgaa ggaagaaatt gattttgaaa
      361 ataattatgt ttatttgcgc aaacgtaact atggctactt ctctagttgg aggtatgtca
      421 atcgttgatg aggatattgc taagcatttg gcgtttgacg gaaaagggga ttgggtgtca
      481 aaaacggtcc atggtttaaa tttattatgt accacgatgc tgctggcagc gaataaaata
      541 tcggaaaagg tgagagaaga gattgcgagg acaaaaagag acatcgcgaa aagacaatcg
      601 tacgtatcag ctgcgacgaa gtcttgggat ggcgatagcg taactctatt acgagatgta
      661 aaatatggag actagcggat agacctccaa aagcgggatt ccactggtgt tgcagtggat
      721 aaccgcctag atcgtgttct agggagccgg gataacaact tac
//