LOCUS       AF276685                 654 bp    RNA     linear   VRL 03-MAY-2004
DEFINITION  African horse sickness virus 8 strain 8 nonstructural protein NS3
            (S10) gene, complete cds.
ACCESSION   AF276685
VERSION     AF276685.1
KEYWORDS    .
SOURCE      African horse sickness virus 8
  ORGANISM  African horse sickness virus 8
            Viruses; dsRNA viruses; Reoviridae; Sedoreovirinae; Orbivirus.
REFERENCE   1  (bases 1 to 654)
  AUTHORS   van Niekerk,M., van Staden,V., van Dijk,A.A. and Huismans,H.
  TITLE     Variation of African horsesickness virus nonstructural protein NS3
            in southern Africa
  JOURNAL   J. Gen. Virol. 82 (Pt 1), 149-158 (2001)
   PUBMED   11125168
REFERENCE   2  (bases 1 to 654)
  AUTHORS   Hiusmans,H., van Niekerk,M., van Staden,V. and van Dijk,A.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUN-2000) Genetics, University of Pretoria,
            Department of Genetics, University of Pretoria, Pretoria, Gauteng
            0002, South Africa
FEATURES             Location/Qualifiers
     source          1..654
                     /mol_type="genomic RNA"
                     /db_xref="taxon:86062"
                     /strain="8"
                     /serotype="8"
                     /organism="African horse sickness virus 8"
                     /note="laboratory reference strain"
     gene            1..654
                     /gene="S10"
     CDS             1..654
                     /codon_start=1
                     /protein_id="AAG17675.1"
                     /gene="S10"
                     /translation="MSLATIAENYMMHNGNQRAIVPYVPSLMRMANAPTLGGQAGEME
                     SMSLGILNQAMSSTTGASGALKDEKAAFGAMAEALRDPEPIRQIKKHVGLRPLKHLKI
                     ELASMRRRYAILRVVTFMSGCVTMATSMVGGLTIIDKEIYDDLSGDGWLSKTIHGLNL
                     LCTTMLLAAGKISDKIQEEISRTKRDIAKRESYVSAASMSWSGDTSVPLKEVKYGES"
                     /product="nonstructural protein NS3"
ORIGIN      
        1 atgagtctag ctacgatcgc cgaaaattat atgatgcata atggaaatca gagagcaatt
       61 gtgccgtatg ttccatccct tatgcgtatg gcaaatgctc cgacgcttgg tggtcaggcg
      121 ggtgaaatgg agtccatgtc gcttgggata cttaatcaag ccatgtcaag tacaactggt
      181 gcgagtgggg ctcttaagga tgaaaaagca gcgtttggtg cgatggcgga agcattacgt
      241 gatccagaac cgatacgtca aattaagaaa catgttggat tgagaccgct caagcattta
      301 aagatagagt tggcgtcaat gagacgtagg tatgcgatac tacgtgtagt gacctttatg
      361 agcgggtgcg taacgatggc tacctcgatg gtgggcgggt taacgattat tgataaagaa
      421 atatatgatg accttagtgg agatggttgg ctgtcgaaga cgattcacgg tttgaatctg
      481 ctgtgtacca ctatgttgtt agcggctgga aaaatatcag ataaaataca ggaggagatc
      541 tcacgtacaa agcgggatat agcgaagaga gaatcatatg tttccgcggc tagtatgtct
      601 tggagtgggg atacgagcgt tccattaaaa gaggtaaaat atggcgagag ctag
//