LOCUS       KM886363                 758 bp    RNA     linear   VRL 23-SEP-2015
DEFINITION  African horse sickness virus isolate HS13/63 segment 10, complete
            sequence.
ACCESSION   KM886363
VERSION     KM886363.1
KEYWORDS    .
SOURCE      African horse sickness virus
  ORGANISM  African horse sickness virus
            Viruses; dsRNA viruses; Reoviridae; Sedoreovirinae; Orbivirus.
REFERENCE   1  (bases 1 to 758)
  AUTHORS   Potgieter,A.C., Wright,I.M. and van Dijk,A.A.
  TITLE     Consensus Sequence of 27 African Horse Sickness Virus Genomes from
            Viruses Collected over a 76-Year Period (1933 to 2009)
  JOURNAL   Genome Announc 3 (5), e00921-15 (2015)
   PUBMED   26358586
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 758)
  AUTHORS   Potgieter,C.A. and Wright,I.M.
  TITLE     The genome sequences of the OIE reference strains of African
            horsesickness virus - comparison to recent and historic AHSV
            isolates
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 758)
  AUTHORS   Potgieter,C.A. and Wright,I.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2014) Research and Development, Deltamune (Pty)
            Ltd, 248 Jean Avenue, Lyttelton, Centurion, Pretoria, Gauteng
            0140, South Africa
COMMENT     GenBank Accession Numbers KM886354-KM886363 represent sequences
            from the 10 segments of African horse sickness virus.
            ##Assembly-Data-START## Assembly Method :: Lasergene v. 8.1.2
            Sequencing Technology :: 454 ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..758
                     /mol_type="genomic RNA"
                     /country="South Africa: Malmesbury"
                     /isolation_source="spleen"
                     /segment="10"
                     /collection_date="1963"
                     /host="Equus caballus"
                     /db_xref="taxon:40050"
                     /isolate="HS13/63"
                     /serotype="3"
                     /organism="African horse sickness virus"
     CDS             20..673
                     /codon_start=1
                     /protein_id="AJT46709.1"
                     /translation="MSLATIAENYMMHNGNQRAIVPYVPPPYAYANAPTLGGQAGEME
                     SMSLGILNQAMSSTTGASRALKDEKAAFGAMAEALRDPEPIRQIKKHVGLRTLKHLKI
                     ELASMRRRYAILRVVIFMSGCVTMATSMAGGLTIIDNEIYEDLSGDGWLSKTIHGLNL
                     LCTTMLLAAGKISDKIQEEISRTKRDIAKRESYVSAASMSWSGDTSVLLKEVKYGDS"
                     /product="NS3"
ORIGIN      
        1 gtttaaatta tcccttgtca tgagtctagc tacgatcgcc gaaaattata tgatgcataa
       61 tggaaatcag agagcaattg taccgtatgt tccaccccct tatgcgtatg caaatgctcc
      121 gacgcttggt ggtcaggcgg gtgaaatgga gtccatgtcg cttgggatac ttaatcaagc
      181 catgtcaagt acaactggtg caagtcgggc tcttaaggat gaaaaagcag cgtttggtgc
      241 gatggcggaa gcattacgtg atccagaacc gatacgtcaa ataaagaaac atgttggatt
      301 aagaacgctc aagcatttaa agatagagtt ggcgtcaatg agacgtaggt atgcgatact
      361 acgtgtagtg atctttatga gcgggtgcgt aacgatggct acctcgatgg cgggcgggtt
      421 aacgattatt gataatgaaa tatatgaaga ccttagtgga gatggttggc tgtcgaagac
      481 gattcacggt ttgaatttgc tgtgtaccac tatgttgtta gcggctggaa aaatatcaga
      541 taaaatacag gaggagatct cacgcacaaa gcgggatata gcgaagagag aatcatatgt
      601 ttccgcggct agtatgtctt ggagtgggga tacgagcgtt ctattaaaag aggtaaaata
      661 tggcgacagc tagaatgacc tccatttgtg ggagatccac agtgttgggt ggatcaaaca
      721 cctagatcgt tttctaggga gccgggataa cgacttac
//