LOCUS       KP009630                 763 bp    RNA     linear   VRL 23-SEP-2015
DEFINITION  African horse sickness virus isolate HS21/07 segment 10, complete
            sequence.
ACCESSION   KP009630
VERSION     KP009630.1
KEYWORDS    .
SOURCE      African horse sickness virus
  ORGANISM  African horse sickness virus
            Viruses; dsRNA viruses; Reoviridae; Sedoreovirinae; Orbivirus.
REFERENCE   1  (bases 1 to 763)
  AUTHORS   Potgieter,A.C., Wright,I.M. and van Dijk,A.A.
  TITLE     Consensus Sequence of 27 African Horse Sickness Virus Genomes from
            Viruses Collected over a 76-Year Period (1933 to 2009)
  JOURNAL   Genome Announc 3 (5), e00921-15 (2015)
   PUBMED   26358586
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 763)
  AUTHORS   Potgieter,C.A. and Wright,I.M.
  TITLE     The genome sequences of the OIE reference strains of African
            horsesickness virus - comparison to recent and historic AHSV
            isolates
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 763)
  AUTHORS   Potgieter,C.A. and Wright,I.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-OCT-2014) Research and Development, Deltamune (Pty)
            Ltd, 248 Jean Avenue, Lyttelton, Centurion, Pretoria, Gauteng
            0140, South Africa
COMMENT     GenBank Accession Numbers KP009621-KP009630 represent sequences
            from the 10 segments of African horse sickness virus.
            ##Assembly-Data-START## Assembly Method :: Lasregene v. 8.1.2
            Sequencing Technology :: 454 ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..763
                     /mol_type="genomic RNA"
                     /country="South Africa"
                     /segment="10"
                     /collection_date="2007"
                     /host="Equus caballus"
                     /db_xref="taxon:40050"
                     /isolate="HS21/07"
                     /serotype="1"
                     /organism="African horse sickness virus"
     CDS             19..675
                     /codon_start=1
                     /protein_id="AJU57281.1"
                     /translation="MNLASISQSYMSHNENERSIVPYIPPPYHPTAPALAVSASQMET
                     MSLGILNQAMSSSAGASGALKDEKAAFGAVAEALRDPEPIRKIKXQVGIQTLKTLKVE
                     LSGMRRKKLILKIIMFICANVTMATSLVGGMSIVDEDIAKHLAFDGKGDWVSKTVHGL
                     NLLCTTMLLAANKISEKVREEIARTKRDIAKRQSYVSAATMSWDGDSVTLLRDVKYGD
                     "
                     /product="NS3"
ORIGIN      
        1 gtttaattat cccttgtcat gaatcttgct agcatctccc aaagctatat gtcacataat
       61 gagaatgaaa gatcaattgt accgtacatt ccgccaccgt atcatccgac ggctccggcg
      121 cttgctgtat ccgccagtca aatggagacc atgtcgcttg ggatacttaa ccaagcaatg
      181 tcaagttcag ctggtgcgag tggcgcgctt aaggacgaaa aggcggcgtt tggagcggta
      241 gcggaggcgt tgagagatcc agagccgatc agaaaaatta agcracaagt aggcatccaa
      301 actctaaaaa cactgaaagt tgaattgagc gggatgcgaa gaaagaaatt gattttgaaa
      361 ataattatgt ttatttgcgc gaacgtaacc atggctactt ctctagttgg aggtatgtca
      421 atcgttgacg aagatattgc taagcatttg gcgtttgatg gaaaagggga ttgggtgtca
      481 aaaacggtcc atggtttaaa tttgttatgt accacgatgc tactggcagc gaataaaata
      541 tcggaaaagg tgagagaaga gattgcgagg acaaaaagag acatcgcgaa aagacaatcg
      601 tacgtatcag ctgcgacgat gtcttgggat ggcgatagcg taactctatt acgagatgta
      661 aaatatggag actagcggat agacctccaa aagcgggatt ccgctggtgt tgcagtggat
      721 aaccgcctag atcgtgttct agggagccgg gataacaact tac
//