LOCUS       NC_018460                834 bp    RNA     linear   VRL 06-NOV-2013
DEFINITION  Aino virus N and NSs genes, segment S, genomic RNA, isolate 38K.
ACCESSION   NC_018460
VERSION     NC_018460.1
DBSOURCE    BioProject accession PRJNA173357
KEYWORDS    RefSeq.
SOURCE      Aino virus
  ORGANISM  Aino virus
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Bunyavirales; Peribunyaviridae; Orthobunyavirus.
REFERENCE   1
  AUTHORS   Goller,K.V., Hoper,D., Schirrmeier,H., Mettenleiter,T.C. and
            Beer,M.
  TITLE     Schmallenberg virus as possible ancestor of Shamonda virus
  JOURNAL   Emerging Infect. Dis. 18 (10), 1644-1646 (2012)
   PUBMED   23017842
REFERENCE   2  (bases 1 to 834)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-AUG-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 834)
  AUTHORS   Hoeper,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAR-2012) Friedrich-Loeffler-Institute, Federal
            Resaerch Institute for Animal Health, Institue of Diagnostic
            Virology, Suedufer 10, Greifswald - Insel Riems 17493, GERMANY
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE795089.
            related sequences HE795087, HE795088. COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..834
                     /mol_type="genomic RNA"
                     /db_xref="taxon:11582"
                     /isolate="38K"
                     /segment="S"
                     /organism="Aino virus"
     gene            26..727
                     /locus_tag="B922_sSgp1"
                     /db_xref="GeneID:13466407"
                     /gene="N"
     CDS             26..727
                     /locus_tag="B922_sSgp1"
                     /protein_id="YP_006590071.1"
                     /gene="N"
                     /db_xref="GOA:B2DCE4"
                     /db_xref="InterPro:IPR001784"
                     /db_xref="UniProtKB/TrEMBL:B2DCE4"
                     /db_xref="GeneID:13466407"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /translation="MANQFIFQDVPQRNLATFNPEVGYVAFIAKHGAQLNFDTVRVFF
                     LNQKKAKMVLSKTAQPSVDLTFGGIKFTLVNNHFPQYTANPVPDTALTLHRLSGYLAK
                     WVADQCKTNQIKLAEAMEKIVMPLAEVKGCTWTEGLTMYLGFAPGAEMFLETFEFYPL
                     VIDMHRVLKDGMDVNFMRKVLRQRYGTLTAEQWMTQKIDAVRAAFNAVGQLSWAKSGF
                     SPAARAFLAQFGINI"
     gene            51..326
                     /locus_tag="B922_sSgp2"
                     /db_xref="GeneID:13466406"
                     /gene="NSs"
     CDS             51..326
                     /locus_tag="B922_sSgp2"
                     /protein_id="YP_006590072.1"
                     /gene="NSs"
                     /db_xref="GOA:J4F045"
                     /db_xref="InterPro:IPR000797"
                     /db_xref="UniProtKB/TrEMBL:J4F045"
                     /db_xref="GeneID:13466406"
                     /codon_start=1
                     /product="non-structural protein"
                     /translation="MFLNGISLRLTRRSGMWHLLLNMGPNSISIPLESSSSIRRRPRW
                     YSVRRHNQVLILHLVASSLHWLITIFPNTQQILCQTLPSLSIVSQDI"
ORIGIN      
        1 ctccactata gaacaaagct tttaaatggc aaaccaattt attttccaag atgttcctca
       61 acggaatctc gctacgttta acccggaggt cgggtatgtg gcatttattg ctaaacatgg
      121 ggcccaactc aatttcgata ccgttagagt cttcttcctc aatcagaaga aggccaagat
      181 ggtactcagt aagacggcac aaccaagtgt tgatcttaca tttggtggca tcaagtttac
      241 actggttaat aaccattttc cccaatacac agcaaatcct gtgccagaca ctgccctcac
      301 tctccatcgt ctctcaggat atctagcaaa atgggttgca gaccaatgta aaacgaatca
      361 gattaaattg gctgaggcca tggaaaaaat tgtcatgcca ctggctgaag tgaaaggttg
      421 cacctggact gaagggctga ctatgtatct gggatttgca ccaggtgctg aaatgttttt
      481 agaaacattt gaattctacc ctttggttat tgatatgcac agagtgctga aggatggaat
      541 ggatgtcaac ttcatgagga aggtccttcg ccagcgctac ggcacattga ctgcagaaca
      601 gtggatgact caaaaaatag atgctgtccg tgcagccttc aatgctgttg ggcagctaag
      661 ctgggctaaa tcaggattct caccagctgc tagagccttc cttgcccaat ttggcataaa
      721 catctaaatt cctgtaaaac cccacccctt cccccagtat ggtgttccaa aacaccatac
      781 gccattcctg cagcattgtt tatttctttc tattgattgt tctatgtgga gcac
//