LOCUS       NC_009896                858 bp    cRNA    linear   VRL 08-DEC-2008
DEFINITION  Akabane virus segment S, complete sequence.
ACCESSION   NC_009896
VERSION     NC_009896.1
DBSOURCE    BioProject accession PRJNA20971
KEYWORDS    RefSeq.
SOURCE      Akabane virus
  ORGANISM  Akabane virus
            Viruses; ssRNA viruses; ssRNA negative-strand viruses;
            Bunyavirales; Peribunyaviridae; Orthobunyavirus.
REFERENCE   1
  AUTHORS   Akashi,H., Kaku,Y., Kong,X.G. and Pang,H.
  TITLE     Sequence determination and phylogenetic analysis of the Akabane
            bunyavirus S RNA genome segment
  JOURNAL   J. Gen. Virol. 78 (PT 11), 2847-2851 (1997)
   PUBMED   9367371
REFERENCE   2  (bases 1 to 858)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAY-2006) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 858)
  AUTHORS   Akashi,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-1997) Hiroomi Akashi, National Institute of
            Animal Health, Department of Virology; 3-1-1 Kannondai, Tsukuba,
            Ibaraki 305, Japan (E-mail:hmitsu@niah.affrc.go.jp,
            Tel:81-298-38-7761, Fax:81-298-38-7761)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB000851.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..858
                     /mol_type="viral cRNA"
                     /db_xref="taxon:70566"
                     /strain="OBE-1"
                     /segment="S"
                     /organism="Akabane virus"
     gene            34..735
                     /locus_tag="AKAV_sSgp1"
                     /db_xref="GeneID:5656563"
     CDS             34..735
                     /locus_tag="AKAV_sSgp1"
                     /db_xref="GeneID:5656563"
                     /codon_start=1
                     /protein_id="YP_001497161.1"
                     /translation="MANQFIFNDVPQRNAATFNPDAGYVAFISKYGQQLNFTVARVFF
                     LNQKKAKMVLHKTPQPSVDLTFAGVKFTVVNNHFPQYTANPVSDTAFTLHRISGYLAR
                     WVAEQCKANQIKFAEAAATIVMPLAEVKGCTWSDGYAMYLGFAPGAEMFLETFEFYPL
                     VIDMHRVIKDGMDVNFMRKVLRQRYGQLTAEEWMTSKLDAVKAAFGSVAQISWAKSGF
                     SPAARAFLAQFGIQI"
                     /product="nucleocapsid"
     gene            59..334
                     /locus_tag="AKAV_sSgp2"
                     /db_xref="GeneID:5656564"
     CDS             59..334
                     /locus_tag="AKAV_sSgp2"
                     /db_xref="GeneID:5656564"
                     /codon_start=1
                     /protein_id="YP_001497162.1"
                     /translation="MFHNGMQLHLIRMQGMWHLSVSMGSSSTLLLLESSSSTRRRPRW
                     SYIRRHNQVSILLLQGSNLQWLITIFPSTLQIQCQTLPLRFTASRAT"
                     /product="nonstructual protein"
ORIGIN      
        1 agtagtgaac tccactatta actacgcatt gcaatggcaa atcaattcat tttcaacgat
       61 gttccacaac ggaatgcagc tacatttaat ccggatgcag ggtatgtggc atttatcagt
      121 aagtatgggc agcagctcaa ctttactgtt gctagagtct tcttcctcaa ccagaagaag
      181 gccaagatgg tcttacataa gacgccacaa ccaagtgtcg atcttacttt tgcaggggtc
      241 aaatttacag tggttaataa ccattttccc cagtacactg caaatccagt gtcagacact
      301 gcctttacgc ttcaccgcat ctcgggctac ttagctcgct gggttgctga gcagtgcaag
      361 gctaatcaga tcaaatttgc agaggcagct gccacaattg tgatgccact ggctgaggtg
      421 aagggttgca cttggagtga cgggtatgca atgtacctgg gatttgcccc tggtgctgag
      481 atgtttctgg aaacctttga gttttaccca ctggttatcg acatgcaccg tgtgataaag
      541 gatggaatgg atgtcaactt catgaggaag gtcttacgtc agaggtatgg gcagctgact
      601 gcagaagagt ggatgacatc taagttggac gcagtcaagg ctgcatttgg ctcagttgcc
      661 caaatatcct gggctaaatc tggcttctca cctgcagcta gagctttcct ggctcaattt
      721 ggtatccaga tctaagctta actgattctc cagttttttc ttttttctct tcctaagtgc
      781 accatgtcta tgtggtgcac acctttgttc agctgcttgg attttattgt ttatagttaa
      841 ttagtggagc acactact
//