LOCUS       KR997917                1160 bp    RNA     linear   VRL 24-NOV-2015
DEFINITION  Avian orthoreovirus strain D1246 segment S3 sigma B gene, complete
            cds.
ACCESSION   KR997917
VERSION     KR997917.1
KEYWORDS    .
SOURCE      Avian orthoreovirus
  ORGANISM  Avian orthoreovirus
            Viruses; dsRNA viruses; Reoviridae; Spinareovirinae;
            Orthoreovirus.
REFERENCE   1  (bases 1 to 1160)
  AUTHORS   Dandar,E., Feher,E., Balint,A., Kisfali,P., Melegh,B., Mato,T.,
            Kecskemeti,S., Palya,V., Banyai,K. and Farkas,S.L.
  TITLE     Genome Sequences of Three Turkey Orthoreovirus Strains Isolated in
            Hungary
  JOURNAL   Genome Announc 3 (6), e01333-15 (2015)
   PUBMED   26586882
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1160)
  AUTHORS   Feher,E., Dandar,E. and Banyai,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAY-2015) Institute for Veterinary Medical Research,
            Centre for Agricultural Research, Hungarian Academy of Sciences,
            Hungaria krt 21., Budapest, Pest H-1143, Hungary
COMMENT     GenBank Accession Numbers KR997909-KR997918 represent sequences
            from the 10 segments of Avian orthoreovirus D1246.
            ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench
            v. 7,0 Sequencing Technology :: IonTorrent; Sanger dideoxy
            sequencing ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1160
                     /mol_type="genomic RNA"
                     /country="Hungary"
                     /isolation_source="feces"
                     /segment="S3"
                     /collection_date="2009"
                     /host="turkey"
                     /db_xref="taxon:38170"
                     /strain="D1246"
                     /organism="Avian orthoreovirus"
     CDS             1..1104
                     /codon_start=1
                     /protein_id="ALG03384.1"
                     /translation="MEVRVPNFHSFVEGITSSYIRTPACWNAKTTWDVETFHLPDVIK
                     VGNAYCCSQCCGVLYYGAPPPDGNCFPHHKCHQQQYRNDTPLLRYVRIGRTTEHLLDQ
                     YAVALQTIADYYEEASLRVANELEENAIAALDIVTRTESIRSDRAVDADFWMYPLERR
                     SDDSRREIAASIWKMIDASARSFTLPDCLVSPSLHSRQVFDQMLTTTSIYDVAASGRT
                     ARFSPMVAALPQRTAGPVTLADADPLDGVATFWSPQFALSPMIGGVGITGQYARESYH
                     HVGHPVVGSGKKVSHYRNLFMEAWRGWSKSSFTCAAGLEPAECESRLRGHARTMLGRS
                     LPGVCDCGLEAQSRAAMSSLQKATKLTFMECGW"
                     /product="sigma B"
                     /note="outer capsid protein"
     misc_feature    1..1098
                     /db_xref="CDD:144537"
                     /note="Reovirus outer capsid protein, Sigma 3; Region:
                     Reovirus_cap; pfam00979"
ORIGIN      
        1 atggaggtac gtgtgccaaa ctttcactct tttgtagaag gtattacatc aagttacatt
       61 agaacccccg cttgctggaa tgctaagacg acatgggatg tcgagacttt ccatcttccc
      121 gatgtaatca aggttggtaa cgcctattgc tgttctcagt gctgcggagt gttgtactat
      181 ggagctcctc ctcccgatgg aaactgcttt cctcatcaca agtgtcatca acagcagtat
      241 cgtaatgata ctccgctctt gcgttatgtc aggatcggcc gcacaactga gcatctgctg
      301 gatcaatatg ccgttgccct tcagactatc gccgattatt atgaggaggc aagccttcgc
      361 gtcgctaacg aacttgaaga gaacgctatt gccgctcttg acattgtaac gagaactgaa
      421 tccatccgta gtgatcgtgc cgtggatgcg gacttttgga tgtatcctct cgaacgaaga
      481 tctgatgact cccggcgtga aatcgctgcc tcaatttgga aaatgatcga cgcttctgcg
      541 cgtagtttta cgctgccaga ttgtcttgtt tctccgtcgc tccattcgcg tcaagttttt
      601 gaccaaatgc tgactacgac atctatctat gacgttgctg cttcgggaag gacggctagg
      661 tttagcccga tggtcgctgc tcttccgcaa cgtactgctg gcccagttac gcttgcagac
      721 gctgacccgc ttgatggagt agccacgttt tggtcccctc aattcgcgct ttcacctatg
      781 attggtggcg ttggtattac aggacagtat gcgcgtgaat cataccacca cgtgggacat
      841 cctgttgttg ggagcgggaa aaaggtgtca cactatcgca acctttttat ggaggcgtgg
      901 cgtggatggt caaaatcatc gttcacgtgt gccgctggtc tagaacctgc tgaatgtgag
      961 tcacggcttc gtggacatgc gcggacgatg cttggccgct ctttgcctgg ggtgtgtgat
     1021 tgtggacttg aagctcagtc tagagctgcg atgtcctccc tacaaaaagc cactaagctg
     1081 acttttatgg agtgtggttg gtaagtacct ctgggtcaaa atgcacgtag gctcccacct
     1141 acgtgacggt tagcgggact
//