LOCUS       KJ476707                1202 bp    RNA     linear   VRL 10-DEC-2015
DEFINITION  Avian orthoreovirus isolate GX/2010/1 segment S3, complete
            sequence.
ACCESSION   KJ476707
VERSION     KJ476707.1
KEYWORDS    .
SOURCE      Avian orthoreovirus
  ORGANISM  Avian orthoreovirus
            Viruses; dsRNA viruses; Reoviridae; Spinareovirinae;
            Orthoreovirus.
REFERENCE   1  (bases 1 to 1202)
  AUTHORS   Li,C., Wei,H., Yu,L., Duan,S., Cheng,J., Yan,W., Zhang,X. and
            Wu,Y.
  TITLE     Nuclear localization of the p17 protein of avian reovirus is
            correlated with autophagy induction and an increase in viral
            replication
  JOURNAL   Arch. Virol. 160 (12), 3001-3010 (2015)
   PUBMED   26350773
REFERENCE   2  (bases 1 to 1202)
  AUTHORS   Shu,C., Duan,S., Li,C., Zhang,X. and Wu,Y.
  TITLE     Complete Genomic Sequence of Avian Orthoreovirus from China
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1202)
  AUTHORS   Shu,C., Duan,S., Li,C., Zhang,X. and Wu,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-FEB-2014) College of Veterinary Medicine, Yangzhou
            University, 12 East Wenhui Ave, Yangzhou, Jiangsu 225009, China
COMMENT     GenBank Accession Numbers KJ476699-KJ476708 represent sequences
            from the 10 segments of Avian orthoreovirus.
FEATURES             Location/Qualifiers
     source          1..1202
                     /mol_type="genomic RNA"
                     /country="China"
                     /segment="S3"
                     /collection_date="Jul-2010"
                     /host="chicken"
                     /db_xref="taxon:38170"
                     /isolate="GX/2010/1"
                     /organism="Avian orthoreovirus"
     CDS             31..1134
                     /codon_start=1
                     /protein_id="AJA90928.1"
                     /translation="MEVRVPNFHSFVEGITSSYLKTPACWNAQTAWDTVTFHVPDVIR
                     VGNAYCCSQCCGVLYYGTLPADGNYFPHHKCHQQQYRTDTPLLRYVRIGRTTEHLLDQ
                     CAVALESIADHYDEISQRMVDEPENDEVAPLDIVTRTESIRSDNTVDPDFWTYPLERR
                     SDDSRRDIAASCWIMIDASSRSLTLPNCLVSPSLHSRSVFGQMQTTTTIYDVAASGKA
                     AKFSPMVATLSQRDAGPVTLANADPAEGVYSFWTSHFAFSPLIGGVGITGQYARESYH
                     HVGHPVIGSGKKASHYRNLFMESWRGWSKSAFACATGMEPAECESRLRGHARTMLGRS
                     LPNVCDDEVAQQSGAVLTSLQKTTKFTVVKCGW"
                     /product="Sigma B"
     misc_feature    31..1128
                     /db_xref="CDD:144537"
                     /note="Reovirus outer capsid protein, Sigma 3; Region:
                     Reovirus_cap; pfam00979"
ORIGIN      
        1 gctttttgag tcctcagcgt gcaagccgca atggaggtac gtgtgccaaa ctttcactcg
       61 ttcgttgaag gaataacatc tagctatttg aagactcctg cttgctggaa tgcacagaca
      121 gcctgggaca ctgtgacttt tcacgtccct gatgtaatta gagttggcaa tgcgtattgt
      181 tgctctcaat gttgtggtgt gctttattac gggactctgc ccgcggatgg aaattacttc
      241 cctcatcaca aatgccatca gcaacagtac aggaccgata ccccactgct ccggtatgtg
      301 cgaattggca gaacgactga gcatctgttg gaccaatgtg ctgttgcgct ggagtctatt
      361 gctgatcact atgatgaaat cagtcaacgc atggtcgatg agccagagaa cgatgaagtc
      421 gcgccccttg acattgtaac gcgtactgaa tctatccgaa gtgataatac ggttgacccg
      481 gacttttgga cttacccgct tgagcgacgt tctgatgatt ctcgtcgaga catcgccgca
      541 tcatgctgga taatgattga tgcatcatca cgtagtctca ctcttccaaa ttgtcttgtg
      601 tccccgtctt tgcattctcg ttccgtcttt ggtcaaatgc aaacgaccac taccatatac
      661 gatgttgcgg cgtcgggaaa ggccgctaaa ttttctccga tggtggctac actatcgcaa
      721 cgtgatgctg gccctgtaac gcttgcgaat gctgacccag cggaaggtgt atattcattt
      781 tggacgtcgc acttcgcctt ctcaccgctc attggtggag ttgggattac gggacagtac
      841 gctcgtgagt cataccatca cgtgggtcat ccagtgattg ggagtggtaa gaaggcgtca
      901 cactacagaa atctgtttat ggaatcatgg cgtgggtggt caaagtcagc tttcgcatgc
      961 gctacaggaa tggagccagc tgaatgtgaa tctcgtctga ggggacatgc tcgcactatg
     1021 cttggacgct ctctgccgaa cgtctgtgac gacgaggttg ctcagcagtc tggcgccgtg
     1081 ctaacgtccc tgcagaagac taccaagttc actgttgtga agtgtggttg gtaagtacct
     1141 ccgggtcaaa atgcacatag gctcccacct atgtgacggt tagcgggact cgcctattca
     1201 tc
//