LOCUS       AY205210                 837 bp    RNA     linear   VRL 26-JUL-2016
DEFINITION  Satellite RNA of bamboo mosaic potexvirus isolate BSL6 P20 protein
            gene, complete cds.
ACCESSION   AY205210 L78264
VERSION     AY205210.1
KEYWORDS    .
SOURCE      Bamboo mosaic virus satellite RNA
  ORGANISM  Bamboo mosaic virus satellite RNA
            Viruses; Satellites; Satellite Nucleic Acids; Single stranded RNA
            satellites; Large single stranded RNA satellites.
REFERENCE   1  (bases 1 to 837)
  AUTHORS   Liu,J.S., Hsu,Y.H., Huang,T.Y. and Lin,N.S.
  TITLE     Molecular evolution and phylogeny of satellite RNA associated with
            bamboo mosaic potexvirus
  JOURNAL   J. Mol. Evol. 44 (2), 207-213 (1997)
   PUBMED   9069181
REFERENCE   2  (bases 1 to 837)
  AUTHORS   Yeh,W.B. and Lin,N.S.
  TITLE     Phylogenetic analysis in short- and long-term dynamics in
            satellite RNA of bamboo mosaic virus
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 837)
  AUTHORS   Liu,J.S., Hsu,Y.H., Huang,T.Y. and Lin,N.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2001) Institute of Botany, Academia Sinica,
            R124, Nankang, Taipei 115, Taiwan
REFERENCE   4  (bases 1 to 837)
  AUTHORS   Yeh,W.B. and Lin,N.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-DEC-2002) Institute of Botany, Academia Sinica,
            R124, Nankang, Taipei 115, Taiwan
COMMENT     On May 6, 2004 this sequence version replaced gi:17466906.
FEATURES             Location/Qualifiers
     source          1..837
                     /mol_type="genomic RNA"
                     /db_xref="taxon:190811"
                     /isolation_source="symptomatic bamboo leaves"
                     /isolate="BSL6"
                     /organism="Bamboo mosaic virus satellite RNA"
                     /host="Dendrocalamus latiflorus Munro"
     CDS             161..712
                     /codon_start=1
                     /protein_id="AAR02611.1"
                     /translation="MVGRRNRRQRSRVSQMTDTMYGSLTLGSTTTWTRKNFPGLANMG
                     DRPFQVISAKIVVSSASPMLYQARLYSPHDDDNVGSTGLQMSGTTPRTHRMRALPGQN
                     TWFSGNTSSTQVIVAIDGLKTKTSDVTPQNAVAVQISYRVAPSELQSATGNAEMPTTT
                     PFDLPEGYEYLADAWLPDRASTS"
                     /product="P20 protein"
ORIGIN      
        1 gaaaactcac cgcaacgaaa cgaaacaaat cgttcagaaa tacttgacca cgaggggccc
       61 cctatagtct gctttggcgg tgcggcagcc cccgtgcgat aggctaactg aggtattccc
      121 cgcactccgt cgagcggtta atacgacgct taccaagacg atggtaggga ggagaaaccg
      181 tcgccagaga tcgcgtgttt cccagatgac cgacaccatg tatggctcac taacactggg
      241 cagtaccaca acatggacca ggaagaattt tcctgggttg gccaatatgg gagatagacc
      301 ctttcaggtc atctctgcaa aaattgttgt ctcgtctgcc tcccccatgc tttatcaagc
      361 caggctctac tcaccacacg atgatgacaa tgtggggtct accgggctac aaatgtccgg
      421 aaccactcca cgtactcacc gaatgagagc tctgccaggt caaaatacct ggtttagtgg
      481 taacacgagc tccactcagg tgattgtcgc tatcgatggc ctgaagacga agacatcgga
      541 tgtcacgccc cagaacgcgg tggccgttca gatttcgtat cgggtggcgc cgagcgaact
      601 ccagagcgca actggtaacg ctgaaatgcc cacaaccacg ccttttgacc tcccagaggg
      661 gtatgaatat cttgccgacg cgtggcttcc tgaccgtgca tcaaccagtt gatccatgag
      721 cacaaccggc ttgtcaatga gccgccacgt ttagcgtggt tccacattga cccaccaccc
      781 atactatgag acctaatcaa tagtggtggt cgtcccgaat aaagacgtta aaagatg
//