LOCUS AF311298 1993 bp DNA circular VRL 09-FEB-2001 DEFINITION Beak and feather disease virus natural-host Eolophus roseicapillus, complete genome. ACCESSION AF311298 VERSION AF311298.1 KEYWORDS . SOURCE Beak and feather disease virus ORGANISM Beak and feather disease virus Viruses; ssDNA viruses; Circoviridae; Circovirus. REFERENCE 1 (bases 1 to 1993) AUTHORS Bassami,M.R. TITLE Genetic studies of beak and feather disease virus JOURNAL Thesis (2000) Murdoch University, Perth, Western Australia, Australia REFERENCE 2 (bases 1 to 1993) AUTHORS Bassami,M.R., Ypelaar,I., Berryman,D., Wilcox,G.E. and Raidal,S.R. TITLE Genetic diversity of beak and feather disease virus detected in psittacine species in Australia JOURNAL Virology 279 (2), 392-400 (2001) PUBMED 11162795 REFERENCE 3 (bases 1 to 1993) AUTHORS Bassami,M.R., Ypelaar,I.B., Wilcox,G.E. and Raidal,S.R. TITLE Direct Submission JOURNAL Submitted (05-OCT-2000) Division of Veterinary and Biomedical Sciences, Murdoch University, South Street, Perth, Western Australia 6150, Australia FEATURES Location/Qualifiers source 1..1993 /mol_type="genomic DNA" /db_xref="taxon:77856" /country="Australia: Western Australia" /organism="Beak and feather disease virus" /host="Eolophus roseicapillus" /note="isolated from feather" stem_loop join(1976..1993,1..12) /note="similar to the stem-loop involved in replication of porcine circoviruses, plant circoviruses and geminiviruses" rep_origin join(1987..1993,1..2) /note="nonanucleotide motif; similar to rep-origin of porcine circoviruses, plant circoviruses and geminiviruses" gene 131..1000 /gene="Rep" CDS 131..1000 /inference="non-experimental evidence, no additional details recorded" /codon_start=1 /protein_id="AAG30555.1" /gene="Rep" /translation="MPSKEGSGCRRWCFTLNNPTDGEIEFVRTLGPDEFYYAIVGREK GEQGTPHLRGYFHFKNKKRLSALKKMLPRAHFERAKGSDADNEKYCSKEGDVILTLGI VARDGHRAFDGAVAAVMSGRKMKEVAREFPDIYVRHGRGLHNLSLLVGSRPRDFKTEV DVIYGPPGCGKSKWANEQPGTKYYKMRGEWWDGYDGEDIVILDDFYGWLPYCEMLRLC DRYPHKVPVKGAFVEFTSKRIIITSNKAPETWYKEDCDPKPLFRRFTRVWWYNVDKLE QVRPDFLAHPINY" /product="putative replicase-associated protein" /note="REP; ORF1; similar to REP protein encoded by porcine circoviruses, plant circoviruses (such as banana bunchy top virus, subterranean clover stunt virus, faba bean necrotic yellow virus and coconut foliar decay virus) and geminiviruses; 33.54 kDa predicted protein" CDS 543..848 /inference="non-experimental evidence, no additional details recorded" /codon_start=1 /protein_id="AAG30556.1" /translation="MGVACITSRYWLVPAHVISRRRLTSSTGPRGVARVNGPMSSRGL NIIKCAVNGGMDMMGKISSSWTTSMGGYLIARCSASATVTHIKCQLRAHLWSLPARG" /product="unknown" /note="similar to beak and feather disease virus ORF5 encoded by GenBank Accession Number AF080560; 10.81 kDa predicted protein" CDS complement(1235..1978) /inference="non-experimental evidence, no additional details recorded" /codon_start=1 /protein_id="AAG30557.1" /translation="MWGTSNCACATFQIRRRYARPYRGRHIRRYRRRRRHFRRRRFST NRIYTLRLTRQFQFKINKQTTSVGNLIFNADYITFALDDFLQAVPNPHTLNFEDYRIK LAKMEMRPTGGHYTVQSDGFGHTAVIQDSRITRFKTIADQTQDPLAPFDGAKKWFVSR GFKRLLRPKPQITIEDLTTANQSAALWLNSARTGWIPLQGGPNSAGAKVRHYGIAFSF PQPEQTITYVTKLTLYVQFRQFAPNNPST" /product="putative capsid protein" /note="similar to capsid protein of porcine circoviruses; 28.82 kDa predicted protein" misc_feature complement(1964..1966) /note="potential alternative start codon" ORIGIN 1 acccgccgcc tggggcaccg gggcaccgca gctattggct gctctgccga ggtgcccgcc 61 cctagggagg agtaaatggc ggcgttatac gccgccgtaa tctccggagg atcacacccg 121 cccgggaacc atgccgtcca aggagggctc cggctgtcgc cgttggtgtt tcacccttaa 181 caaccctaca gacggcgaga tcgaattcgt ccgtactctc gggcctgacg aattctacta 241 tgccatcgtt ggacgggaaa agggcgagca aggtaccccc catttgcgag gctactttca 301 ttttaaaaat aagaagcgac tgagcgctct taagaaaatg ctgccgcgag ctcattttga 361 gcgcgctaaa ggtagcgatg cggataatga gaagtattgc agtaaagagg gggatgttat 421 acttaccctg ggcattgtgg cgagagacgg tcaccgcgct ttcgacggag ctgttgctgc 481 cgtgatgtcc ggacgcaaaa tgaaggaagt cgcgcgagag ttcccagata tctacgtcag 541 gcatgggcgt ggcttgcata acctctcgct attggttggt tcccgcccac gtgatttcaa 601 gacggaggtt gacgtcatct acgggccccc ggggtgtggc aagagtaaat gggccaatga 661 gcagccgggg actaaatatt ataaaatgcg cggtgaatgg tgggatggat atgatgggga 721 agatatcgtc atcctggacg acttctatgg gtggctacct tattgcgaga tgctccgcct 781 ctgcgaccgt tacccacata aagtgccagt taagggcgca tttgtggagt ttaccagcaa 841 gaggataatt attacgagca ataaggcccc cgagacctgg tacaaggagg actgtgaccc 901 gaagccactg ttccggaggt tcacacgtgt ttggtggtac aacgtggaca agttggaaca 961 agtccggcct gacttcctcg cccaccccat caattactga tagtttcggt gatgttttca 1021 taaaggtagg cgtcgggccg aaggcccgat gccgcagggg gggaccccct gccggagggc 1081 ttgcagggcc gtcaggcccg agagaccgac cagcccggag ggcgtagtct gtgtcggggg 1141 gggggccccg gggggtcccc ccgacacgac gaacacggtc agcgccgaag gcgccaataa 1201 acactcgaaa aggtatttgc tgtctgagtc cttattaagt actgggattg ttaggggcaa 1261 actgacggaa ttgaacatac aaagtgagct tggtcacata agtgatcgtt tgttctggct 1321 gggggaagct gaatgcaatg ccgtagtgcc ggactttcgc tcccgctgag ttgggtcctc 1381 cttgtagtgg gatccagccg gttctggcgc tgtttagcca caatgccgca gactggtttg 1441 ctgtggtcag gtcctctatc gttatttgtg gtttgggtct gaggaggcgt ttgaatcccc 1501 tgctaacaaa ccatttcttg gcaccgtcga aaggtgctag agggtcttgt gtttggtctg 1561 caatagtttt aaatctagtt attctggagt cttggattac ggccgtgtgg ccgaatccgt 1621 ctgattgtac ggtgtaatgt ccccctgtgg gcctcatttc cattttagct aacttaattc 1681 ggtaatcttc aaaattgagt gtgtgtgggt ttgggacggc ttgtaggaag tcgtccaacg 1741 caaaggtaat gtagtcagca ttaaagatta ggttgccaac actggtggtt tgtttgttaa 1801 ttttgaattg gaattggcgc gtgagtctga gagtgtaaat tctattggtt gagaaacggc 1861 gtctgcggaa gtgcctacgt cgccggcggt atcgcctgat gtgacgtccg cggtatgggc 1921 gggcatatct tcgtctaatc tgaaatgtag cgcatgcgca gttagaggtg ccccacaggc 1981 ggcggttagt att //